PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00007903001
Common NameGSBRNA2T00007903001, LOC106436817
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 307aa    MW: 34060.7 Da    PI: 8.779
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00007903001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.91e-383392261
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                          +++lkcprC+s+ntkfCyynnyslsqPr+fCk+CrryWt+GGalrnvP+Ggg+rk kk+
  GSBRNA2T00007903001 33 DQQTLKCPRCNSSNTKFCYYNNYSLSQPRHFCKSCRRYWTRGGALRNVPIGGGCRKTKKT 92
                         57899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027014.6E-333591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5533791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-263991IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MSSHTNLHSP KPDHRTTGTP HTKKPPSSST SQDQQTLKCP RCNSSNTKFC YYNNYSLSQP  60
RHFCKSCRRY WTRGGALRNV PIGGGCRKTK KTFKPNSVIT PSSSSSQRFF SSIMEDSTKF  120
FPPPTTMDFQ LAGLSLNKIN DLQLMNNQEV LGLRPMDQVE TTPVDVGSGL SLMGFGDYSN  180
NNHSTGTFTT AGATDGNLAT SIETLSSLNQ DLHWRLQQQR MAMLFGSSKE ETVVVERPQP  240
ILYRNLEIVN SSQSPTKKGD NQTEWYFGNN NDTEGVANNN NNTGGSEQWN NGVQAWTDLN  300
HYNALP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625923.10.0PREDICTED: dof zinc finger protein DOF5.7-like
RefseqXP_013733218.10.0PREDICTED: dof zinc finger protein DOF5.7-like
SwissprotQ9LSL61e-179DOF57_ARATH; Dof zinc finger protein DOF5.7
TrEMBLA0A078JTF50.0A0A078JTF5_BRANA; BnaCnng70020D protein
TrEMBLA0A0D3BEQ40.0A0A0D3BEQ4_BRAOL; Uncharacterized protein
STRINGBra024399.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49502850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.11e-158Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]